PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DL_1D036F8B5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 126aa    MW: 14467.7 Da    PI: 9.9521
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DL_1D036F8B5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.4e-181461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd+ lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Traes_5DL_1D036F8B5.1 14 KGPWTPEEDLMLVSYIQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding53.65.2e-1767112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Traes_5DL_1D036F8B5.1  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.83961IPR017930Myb domain
SuperFamilySSF466894.21E-3111108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002499.3E-171461IPR001005SANT/Myb domain
CDDcd001672.05E-111661No hitNo description
PROSITE profilePS5129424.72262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-2565117IPR009057Homeodomain-like
SMARTSM007174.3E-1666114IPR001005SANT/Myb domain
PfamPF002491.0E-1567112IPR001005SANT/Myb domain
CDDcd001671.84E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYIQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ  120
DAGGND
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-28141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-271411627128MYB TRANSFORMING PROTEIN
1mse_C7e-28141164105C-Myb DNA-Binding Domain
1msf_C7e-28141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519140.0JF951914.1 Aegilops tauschii clone TaMYB31 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009410391.11e-85PREDICTED: myb-related protein 306-like
SwissprotP813921e-82MYB06_ANTMA; Myb-related protein 306
TrEMBLG9DR772e-92G9DR77_AEGTA; R2R3-MYB protein
STRINGMLOC_34885.18e-89(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.12e-84myb domain protein 94